DPCstruct | MC41170
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 96 ± 20 aa |
| Standard deviation of domain lengths | 19.99 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 77.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 49.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815IR54 | 1-57 | MDTTQQYHVGKDYSNAPAKVFEKVEKYDEDFIDRTRIPRMPWHDEGVVVLGESARDL |
| A0A821PVH8 | 17-110 | DTSISESSDTKPKTIVGVTSVVDETHQFFLGKDYSNYYQKDFEFIEKFDEDYIDRKLVPRMPWHNEILVVSGEAARDCVRHFIQRWN… |
| A0A817NSN3 | 306-381 | None |
| A0A815ZQL1 | 2-100 | None |
| A0A815WR22 | 2-113 | None |
| A0A3M7S3Q2 | 40-145 | None |
| A0A2G9RT51 | 1-124 | None |
| A0A821J7K7 | 55-148 | None |
| A0A820YLZ3 | 167-236 | None |
| A0A0R3TBY1 | 203-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.