DPCstruct | MC4117
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 153 ± 16 aa |
| Standard deviation of domain lengths | 16.08 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 17.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5S3QFW2 | 2-184 | ITDEEILKKAGNLNDLIETQWINQIFLSPSWIFQVVLIIFTYTIFFYLVDKKRITEILLYGSLVAVAFAVYDSIGEQLNYWATLENV… |
| A0A1Y0IKW1 | 4-152 | EWKVLFWTSVAMILLAWWLVPRDKIRDFQILFLFAQAYTWLALLILVEIKWIRFPVREFPHASETGFTMHFLIYPVMGALLVLFYPE… |
| A0A2N0Z062 | 1-121 | None |
| A0A0U1L0A3 | 106-251 | None |
| A0A845KYY8 | 4-185 | None |
| A0A0Q7JEU7 | 1-163 | None |
| A0A517E017 | 6-151 | None |
| A0A1W2AHV8 | 1-156 | None |
| A0A0Q7IUY2 | 3-142 | None |
| A0A1V9B3D7 | 11-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.