DPCstruct | MC41168
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 434 ± 78 aa |
| Standard deviation of domain lengths | 77.86 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 75.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.69 |
| Pfam Score | 81.82 |
| Assigned Pfam label(s) | CL0229- PF13705 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A553P935 | 54-470 | RLEEVANVILRVPSILVLDLLYKCDVDSFTDHLKARTEDMLFKYKYVIWNIYYLGHIVSVVVLLLPLGRIIQLYLHVLAALLLYMGH… |
| A0A336M4R1 | 2-479 | SLKLRFLCFLDIFLRVPSLIFIDEILKTDFFYEFSFSFVKNYPKYKVLEVIFLETIPIGLFKLIVCLLGSIFAFLLFILWTSHLLQT… |
| A0A044UZ17 | 173-625 | None |
| A0A498NW53 | 2-272 | None |
| A0A821RPK6 | 1-338 | None |
| A0A1I8HRH6 | 1-432 | None |
| A0A6M2CKW8 | 1-412 | None |
| A0A814ATD4 | 298-868 | None |
| V5HD82 | 1-353 | None |
| J9K6E2 | 4-498 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.