DPCstruct | MC41164
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 98 ± 14 aa |
| Standard deviation of domain lengths | 14.11 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A2K2L3 | 84-162 | MPLQLAKRDGRVCQVPRLMLVTKDIVLLRPGQKAPCNCELVDGKELHQGEKLERQMQVCEETDAIEPLELVEARVTSSP |
| A0A553NG62 | 1-116 | MLKYPSDNGLRGSGDLLSPLSAAVSCQWTFRDGKLVNLPICLLVEDDIIALRPGSEAPTELRGIQEAEHVVLSRSDVFSHLSSPPSP… |
| H3B0F8 | 141-237 | None |
| A0A6G0HZS1 | 154-249 | None |
| A0A1S3JDU6 | 76-170 | None |
| A0A401SM40 | 112-191 | None |
| T1FEU9 | 24-124 | None |
| A0A2D0Q571 | 118-214 | None |
| A0A016S4Z0 | 130-227 | None |
| A0A368F2U1 | 1-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.