DPCstruct | MC41163
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 385 ± 25 aa |
| Standard deviation of domain lengths | 25.49 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 78.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 42.92 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | PF13948- CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0VA35 | 382-794 | KNKLKLDGSTHLNIFFANSSEEELAGMATFPWDKEALVHLGGIVLNPSFYGIAGHTHTMIHEIGHSLGLYHVFKGISEIFSCSDPCM… |
| A0A553N5F5 | 1-403 | MKGGMIINPGYFGTKGHNNTMIHEMGHIFGLYHVFKGVSERESCDDPCQETTASMETGDLCADTAPMPKSKACQDPDPVNDTCGLTQ… |
| A0A2I0TKH3 | 1-384 | None |
| A0A498MRY4 | 61-470 | None |
| A0A183VF10 | 52-419 | None |
| A0A444UPL4 | 264-643 | None |
| A0A1S3IPY2 | 589-923 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.