DPCstruct | MC41162
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 143 ± 15 aa |
| Standard deviation of domain lengths | 14.58 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9HFA2 | 15-169 | FHMLYNPSQFDTKEEIHEGDSKFDKKLVAVDLVLSPTSGKKVSQLQKGDFIYVLIDTSTPYGYDVAKTLNLIVDHKNTPIEAEVYSV… |
| A0A1C0AAP1 | 168-293 | INEDDELDNIEEEIIELDVTPIIAPIDGKKISQFEKNDEILVKAREDSYNEYRDIIFNFIVDANKRHIKGVIDYILFNDSIKTYDII… |
| A0A1V5K048 | 215-363 | None |
| M3I3S5 | 17-188 | None |
| M3IEB0 | 4-138 | None |
| A0A7Y3L1M8 | 102-238 | None |
| A0A3D2PA43 | 1-125 | None |
| A0A522CMX7 | 173-324 | None |
| A0A2N2F0D8 | 168-300 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.