DPCstruct | MC41161
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 89 ± 8 aa |
| Standard deviation of domain lengths | 8.22 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5X9B1 | 20-102 | SVTLWLGESCIQTTAKQAYHALMAVLLESDASEADQHAAETLRLFLSEMDFASLRSRYPAMAGGVDCRVRIHLLDERQCLWEI |
| A0A7X9HEX0 | 5-89 | IKVTLYLNGHCVETAAKETLQKLLEAMLQSETEDQNLQEQYQLLYDFLHTADFKQLRASDESLTGIVPSICEIYRDDAGKPAIRI |
| A0A662VQX8 | 2-79 | None |
| E1YAL0 | 1-98 | None |
| S7U4J4 | 2-98 | None |
| A8ZZI8 | 46-133 | None |
| C0QEU1 | 24-109 | None |
| A0A1W1HJH7 | 1-107 | None |
| A0A7X9HNR1 | 14-98 | None |
| A0A7C4MNN8 | 28-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.