DPCstruct | MC41157
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 335 ± 74 aa |
| Standard deviation of domain lengths | 74.26 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 91.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0339 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V1MKZ1 | 8-364 | IKKRLFEEYYQKKEWWGDEESIFDDNHDFVKEPLVIRKAMAVQKVCRDMPIRIIDFELIVGNPTMASVGFGHCFPKYETDEEAEIAA… |
| A0A829I526 | 51-373 | NGEIPDGMTERLVKLKETYLKHVPTITTHRARAITKIAKENPGTPKSVLRGKCFKHCCETAPLVIQDNELIVGAPNGQPRAGAFSPD… |
| T0E668 | 60-328 | None |
| B0N617 | 3-367 | None |
| A0A377ZC21 | 2-228 | None |
| A0A1Y1UIZ4 | 1-272 | None |
| A0A1V5GIN8 | 11-291 | None |
| A0A7V3DY23 | 3-445 | None |
| A0A6G3I5S2 | 3-281 | None |
| A0A5K8A291 | 76-458 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.