DPCstruct | MC41154
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 153 ± 12 aa |
| Standard deviation of domain lengths | 11.82 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X6UN29 | 136-283 | TDRSMALGKFFYIAKAAGRNPNHYLESVYTEDENGKMERVTIYHPAYYRNMLVRLYMFNADALIPNETPVITLTPHMLANGQVRYII… |
| A0A2M7H7W5 | 1-153 | MIDYAMPVGKFYAQVTWAGKNMSDFYDVYYVPVGGGVLQPHVLYHPAYYNSTVVRLYNFNGEAVVPAENATIVISYRDQVDRQGSGY… |
| A0A843DX46 | 285-451 | None |
| A0A843LF83 | 63-207 | None |
| A0A847EKI8 | 1-146 | None |
| A0A0P7HV56 | 62-212 | None |
| U1QMK5 | 133-275 | None |
| A0A7K4DE38 | 446-620 | None |
| A0A0W8F4C1 | 101-263 | None |
| A0A6G0EIR8 | 710-836 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.