DPCstruct | MC41153
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 115 ± 7 aa |
| Standard deviation of domain lengths | 7.46 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09149 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V2W9V1 | 107-224 | AITKRGQPPLFLGPGPSTKIRYDKLFCCFNEGNGLLFRLVDEIHHTWAYYNDTMEYTMNITVSFGRESTVEAIGKAECIIMDAALGI… |
| Q57UN6 | 2-113 | SDITYENGSPTYTGNTVLKCFRENGNGLLFRIVNDEEKKWAFYNDTKGYNMVVKVAFGKDSTVQPLGNTKMEKDTATGEFKCELEIA… |
| F9WCY3 | 165-271 | None |
| A0A7G2C2X9 | 433-543 | None |
| A0A0N0DS15 | 76-179 | None |
| A0A7G2CE37 | 146-269 | None |
| A0A7G2CD68 | 11-129 | None |
| A0A7G2C8T5 | 13-138 | None |
| A0A7G2C6J1 | 11-122 | None |
| A0A7G2C3D4 | 107-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.