DPCstruct | MC41152
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 164 ± 22 aa |
| Standard deviation of domain lengths | 22.00 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 46.93 |
| Pfam Score | 93.00 |
| Assigned Pfam label(s) | CL0023- PF20445 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V2W5C1 | 226-378 | SAPMKLEGFYESVHNARWHHVVEVSGGEGMGMGVHEGKPQQSWTYMAVGQTVEKDDGVQQSGAPRPRLIVLTSDKGWPYSWEEDKPI… |
| Q4D7N8 | 146-313 | YESVYNARWHHVVEVPGGEGTGMEVKKGRPPQQWTYKKVGRTLEKDDGAQQSGAARLRLMVLTSDKAWPCTWNRKGVESTRDCYVNC… |
| A0A2V2W959 | 4-159 | None |
| A0A2V2W6S4 | 144-309 | None |
| A0A2V2W5Y4 | 1-163 | None |
| A0A2V2W3P1 | 3-154 | None |
| A0A2V2VZX2 | 480-635 | None |
| A0A7J6XQT8 | 312-467 | None |
| V5D3V3 | 49-231 | None |
| V5A4R3 | 257-424 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.