DPCstruct | MC41150
Metacluster Properties and Pfam Annotations
| Number of structural domains | 93 |
|---|---|
| Mean domain length (aa) | 148 ± 23 aa |
| Standard deviation of domain lengths | 22.57 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 33.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V2W2S5 | 15-180 | QRRARPESENVTDQPAATHIRVEEARRTQWTMSSTVRDILMEGSTSRTNMKLNDFLRSNLGGTAAVGEDHNVTMQAFVQEPDAYIQD… |
| A0A2V2WG63 | 1-105 | MKLNDFLRGHIGPSAVVDERYNVTMEVFLVEPRNYVQDQKLLEEIFNLSEYQVLQEMRGLRRDTYNVSQMGVRSLRQWRDFERKDMV… |
| A0A2V2VZX2 | 20-186 | None |
| A0A2V2W3Y1 | 20-178 | None |
| A0A2V2WAF8 | 82-244 | None |
| A0A2V2W6S4 | 1-134 | None |
| A0A2V2VXN8 | 7-153 | None |
| A0A3R7NV91 | 2-120 | None |
| A0A3R7RFM1 | 48-181 | None |
| A0A2V2W5C1 | 86-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.