DPCstruct | MC4115
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 87 ± 10 aa |
| Standard deviation of domain lengths | 10.48 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C4JEJ2 | 1-73 | MHSSDVTFDPSNMYSNNPAERMRIINLVISQAPARAASASVVNGWHTSRSDRRQHCTVDYYDAAGSRISRNHI |
| A0A165PQX9 | 1-82 | MSSIKVSWKNPNEYKNQPAKKQEVETDVKDSSQSSAAERKGATEAIIRGGIHKSQPGGDQKEHVTVDYKKADGDHVTTKHVY |
| K5W789 | 187-280 | None |
| A0A1L7VIM0 | 1-81 | None |
| A0A0F4G6C3 | 8-87 | None |
| A0A409XJY5 | 81-189 | None |
| A0A074YTN6 | 2-82 | None |
| A0A163CT89 | 1-80 | None |
| A0A0C9WPG2 | 96-195 | None |
| A0A5C6TJ30 | 1-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.