DPCstruct | MC41149
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 159 ± 26 aa |
| Standard deviation of domain lengths | 26.12 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.80 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF01369- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V2VVV4 | 1-186 | MNFGHLMVNETKTIFRHLFFRVLESKTSSLTQKSIVVEAFHRYIEEPQNLIALFLNYDCNTSSQSVYEQMIGYLAALSVPFGMKMDA… |
| A0A2P5WVM7 | 15-142 | FRSGLKAEIGILFPMLILRVLENVLQPSFLQKMTILNLLDKIGGNSQIIIYIFVNYDCDVDSPNIFERVVNGLLKTSLRPPSGSTTT… |
| A0A7J8N6K2 | 1-168 | None |
| A0A448X7G7 | 161-314 | None |
| A0A820AJ38 | 130-339 | None |
| A0A3P7DC22 | 559-702 | None |
| C5LKR4 | 110-247 | None |
| A0A3Q0KMF2 | 570-710 | None |
| A0A2V2UVI5 | 150-320 | None |
| A0A0R3R1W4 | 175-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.