DPCstruct | MC41147
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 109 ± 16 aa |
| Standard deviation of domain lengths | 15.97 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 23.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B1YSP7 | 3-99 | TSTTLVSALEDYTVNLSVDFSNRNESNFIGFFAGHRHAEYFYDMSGYYSTVLDCSFVRDDSKIGLVQEDAFCVVEVNIDNRQVKILG… |
| A0A022NBD0 | 236-347 | LLKALLTAFINKESTQLHSNLSDFVVDFSVDFTQRKESHLVGLFAGHRHEEYFYSTNEMGGYYSTVFDCAFVRDDSKLGLVAEDAFA… |
| A0A1Q6RIN2 | 4-110 | None |
| W0FT18 | 7-95 | None |
| A0A242K6E1 | 445-534 | None |
| A0A354WUJ8 | 156-282 | None |
| A0A2C9X3I6 | 467-578 | None |
| C9A1B1 | 729-842 | None |
| W7CMD6 | 59-169 | None |
| A0A1V9QUF5 | 658-769 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.