DPCstruct | MC41145
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 78 ± 5 aa |
| Standard deviation of domain lengths | 5.49 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 93.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 71.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0722 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A650GEA3 | 3-67 | NGIKVSGTSYDLDPVQGAFNIGAMIRWLDFNNTWSTAEWGHPSDNLGGILAVADYLSCKAVASGK |
| A0A2V2KZC1 | 18-92 | VPNGARVPGTSYRLDPVKAAWDIGCTVRWLDYNDTWLAAEWAHPSDNLGGILAVADHLSQKRVAAGEKPLLMREV |
| I6DTE0 | 70-148 | None |
| A0A177TYK2 | 24-110 | None |
| A0A077ZGJ2 | 70-148 | None |
| A0A1L9SJ97 | 650-729 | None |
| A0A2G7G503 | 706-782 | None |
| W9C6K7 | 55-134 | None |
| A0A0B7IYJ2 | 70-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.