DPCstruct | MC41140
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 55 ± 5 aa |
| Standard deviation of domain lengths | 4.72 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 67.74 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | CL0465- CL0422 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498N619 | 1-67 | MNDKYHKAARDGYLDLLKEATRKDLNAPDEDDMTPTLWAAYHGNLEALRLIVGRGYLNAILQQTRFK |
| A0A6P5WA45 | 1-55 | MSSDRFHKAAKDGLLDVLSAATRKDTNAKDSDSMTPVMWAAFEGRLDALRLLCGR |
| A0A662Z0V4 | 314-369 | None |
| A0A4Y2UK37 | 4-59 | None |
| A0A402F6G2 | 32-82 | None |
| A0A5C6PQY6 | 1-55 | None |
| A0A6A4X394 | 312-361 | None |
| A0A4W5QU76 | 1-55 | None |
| A0A7R9ISQ1 | 2-50 | None |
| A0A2R7W7N2 | 53-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.