DPCstruct | MC4114
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 209 ± 27 aa |
| Standard deviation of domain lengths | 27.44 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.06 |
| Pfam Score | 71.90 |
| Assigned Pfam label(s) | PF14934- PF10615 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y9YHF8 | 7-220 | SKSGFLCMYMSNHPDTLVGYVKHWGKVAEDVSSAKMTSIDTKGMTLAYKTKAGGPEKEVRVLFDPPLLGYEEVKPRLISMKVDAEEA… |
| A0A165N432 | 7-219 | SKSSFLCMYMSNHPDTLVAYVKHWGKVADDVSGAKMTSIDTNGMNLTYKTKAGGPEKEVRVQFDPPLLGYEEVKPRLISMKVDAEEA… |
| B8PMM4 | 7-194 | None |
| A0A1Y1W397 | 22-239 | None |
| A0A084REL8 | 460-675 | None |
| A0A7S4A898 | 110-307 | None |
| A0A1B7MME4 | 3-215 | None |
| Q2GV85 | 11-239 | None |
| A0A7S0ETK4 | 15-167 | None |
| A0A427YUZ4 | 6-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.