DPCstruct | MC41138
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 109 ± 14 aa |
| Standard deviation of domain lengths | 14.08 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 28.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0498 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G0Z723 | 45-152 | DWSPELVAIEAKAKDEAKVLLFVIDGQTRAGVSIMEALKYGADGRTVILSIENIPTGTVIENQEILGRDLKDANRMRSYLGDLVKEY… |
| A0A6P5VIL8 | 104-198 | PSLLDSSRVLLFVITNETRSLAPMTLAAHCIGLMYNVVLAVQMLPEDCVLGGEKLTVAAIKDYNRGRSYLIDLAKRQGVPVFNDIRA… |
| A0A816YTF9 | 112-243 | None |
| A0A023FP98 | 280-376 | None |
| A0A6L5CX43 | 151-263 | None |
| A0A7S2WAY2 | 184-285 | None |
| A0A662X400 | 9-147 | None |
| A0A132A323 | 207-302 | None |
| A0A1B6GG56 | 2-118 | None |
| A0A6I9W128 | 11-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.