DPCstruct | MC41133
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 176 ± 15 aa |
| Standard deviation of domain lengths | 15.46 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 67.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 48.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20520 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7N0RIZ5 | 134-322 | ATSDVQNMESSLIAGFTKTCGHGHVKNRVAFTESCSVEGTEYKKLSDLQSVDDFVFSSVGKSKVAADLLVFCHRDSDAIGKPQETES… |
| A0A4S4DDH6 | 1-176 | MESMLISEFTETCGHNFGASKVAFLESCSLEGGNYEKLADLHTVNDYLVSRMENRPKGQADLVVACQGSSHSERQIFSELINSVEQS… |
| A0A6P5RMU5 | 31-202 | None |
| A0A2J8A7Y9 | 5-163 | None |
| A0A7J7LYW6 | 93-268 | None |
| A0A7J6V8P9 | 130-321 | None |
| A0A5P1EDA1 | 2-153 | None |
| A0A2I0BGQ0 | 223-386 | None |
| A0A6A1WRB9 | 1-199 | None |
| A0A2P2M1Z8 | 1-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.