DPCstruct | MC41131
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 154 ± 8 aa |
| Standard deviation of domain lengths | 8.10 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 43.57 |
| Pfam Score | 90.95 |
| Assigned Pfam label(s) | CL0505- CL0033 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3QYK0 | 47-212 | SGSMMPSEKDEQGAYLIDRSARYFEPIINYLRHGQFVCEENVSLKGVLEEARFFGIYNLVTELEELLEKQEQEQQVADIPLTRMDVI… |
| A0A7C8YS24 | 71-222 | MFSGRHTVCHDPDKGCVFVDRDGKHFRHILNWLRDGVVPTLKDSEYAELLREAEYYQLLGLIEGINATLNNKRKEGDDLSSELSRRD… |
| A0A7M5X8V8 | 172-322 | None |
| A0A2I3N6W6 | 125-282 | None |
| A0A7J6F9W8 | 310-460 | None |
| A0A2G5EEF4 | 43-212 | None |
| A0A6J5VCH7 | 32-185 | None |
| F2UC25 | 45-206 | None |
| A0A251TEP9 | 37-186 | None |
| A0A251TE61 | 149-300 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.