DPCstruct | MC4113
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 87 ± 10 aa |
| Standard deviation of domain lengths | 9.81 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 43.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9JCL0 | 246-319 | ETYRYRMTYGLSQTGDTNKPMVVPKGAEVLLESRFPYLDDTQRRYVLYTTGIESGYPVLDDAEGWGRLNLFEAA |
| A0A7X6IIY4 | 1-81 | DPDDIRGYTYRMTYGLALAASMKLPETVPVQAQVLLLTRFPYATDEQRTEILRSTALPAGFALLDGNTWDGWGRLNLYAAV |
| A0A1C4MSH3 | 422-520 | None |
| A0A7K2PD39 | 595-694 | None |
| W4TXK2 | 8-104 | None |
| A0A2S5VAD9 | 242-328 | None |
| A0A7T4D5N9 | 292-388 | None |
| A0A518VK93 | 360-436 | None |
| A0A7G6VBD3 | 226-304 | None |
| A0A3D1ZAX3 | 12-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.