DPCstruct | MC41128
Metacluster Properties and Pfam Annotations
| Number of structural domains | 101 |
|---|---|
| Mean domain length (aa) | 222 ± 45 aa |
| Standard deviation of domain lengths | 45.04 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 79.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03169 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4CWP1 | 250-472 | TENTKQSLLLWALHEKEERHKGGLTRNQFFLIAFICSFAYYVIPGYLFPMSTAFSWLCLLFPNSVLAHQLGSGLRGLGIGAFGLDWS… |
| M1AQ18 | 9-201 | QVSLFRALHEKDDRRMSRAKFFLIALICSFCWYLVPGYLFSTLTSISWICWAFSKSVTAQQIGSGMRGLGVGAITLDWSAVASFLFS… |
| A0A820MDZ0 | 1-161 | None |
| A0A4S4DPC3 | 33-207 | None |
| M0ZW46 | 139-336 | None |
| A0A822HHY7 | 2-164 | None |
| R1EES7 | 315-490 | None |
| R1G156 | 99-326 | None |
| A0A146IEL9 | 95-326 | None |
| A0A177U433 | 243-442 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.