DPCstruct | MC41124
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 253 ± 44 aa |
| Standard deviation of domain lengths | 43.67 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U6XVW8 | 11-255 | PLALRKNSIYVSSAIYNLKTFASNYGDDGKSELNSICHARSLILDLDDRPKNERVTYCGVVVRQGGKLALVFAEGNLGTNADYALDA… |
| A0A397JDH4 | 220-434 | GEIVYGYFDSLINYIKNYTQKDDLVRSEFLITTSTRKFNFVIDDEIEEYNVTEVKDGTLFIKVKRTTLGTNSSSIGYNLIDVIKVPD… |
| F4PYM9 | 3-276 | None |
| A0A146HLD2 | 6-301 | None |
| A0A0A1TAH2 | 2-185 | None |
| A0A0J0XLF5 | 2-196 | None |
| Q557C7 | 1052-1355 | None |
| Q54BI8 | 4-262 | None |
| D2W0S3 | 1-301 | None |
| F0ZIG9 | 43-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.