DPCstruct | MC41121
Metacluster Properties and Pfam Annotations
| Number of structural domains | 153 |
|---|---|
| Mean domain length (aa) | 142 ± 28 aa |
| Standard deviation of domain lengths | 28.48 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 84.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 16.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18431 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A849KBE9 | 48-193 | RVASVRMGQVNLMRHEAVKGFSGGGHTLRKHVGKSERELLEKVKRGIQSGSFKEGNAASSFISLHIAEQAISKAVKANRAEIRQWAK… |
| A0A7X9E8W8 | 71-218 | MTPSERSARLQQLAEENAYRRLQEMENSIPGAHFLEKHGAQTTLQSQLDRVQFGINPTTKVVETWPNGNIKYPSSGTRFLNYRDQLN… |
| A0A396RKR0 | 216-382 | None |
| A0A429CFL9 | 726-914 | None |
| A0A7Y7Z5E8 | 40-198 | None |
| A0A7D5VPC5 | 74-232 | None |
| A0A1N6YMT1 | 237-327 | None |
| A0A2H0PBV9 | 229-354 | None |
| A0A7X6KGR3 | 260-431 | None |
| A0A6G0ZS07 | 808-991 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.