DPCstruct | MC4112
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 131 ± 22 aa |
| Standard deviation of domain lengths | 21.65 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 17.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K0JN49 | 16-119 | ISCSLEDEYIYMVKYGNFNAYPDVTVGEMVNTIFDEVEWEQIVADDGKDYVNMHGTINGEVASIQFKILNDESWIVYALEINGIPDT… |
| A0A292YDQ8 | 15-139 | VLVNGCLNSDISTVKNGYLNDFKTISVGEAFDKYKYFTDVKWDSFETDNGTKIVEVKGYLNEDANKTKISNKPYLLTQFKINKADNT… |
| A0A8A8EVA6 | 1-167 | None |
| A0A3A6IY17 | 286-421 | None |
| A0A1V5GYF6 | 1-166 | None |
| A0A416CDT4 | 225-335 | None |
| J8A0K8 | 24-145 | None |
| A0A7J5WEF4 | 3-120 | None |
| A0A164GN79 | 1-104 | None |
| A0A417W0Z9 | 140-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.