DPCstruct | MC41119
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 79 ± 9 aa |
| Standard deviation of domain lengths | 9.21 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 44.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0014 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4PT87 | 1-75 | MTMARNGREIFVTGHSEYSPFTLDMEYRRDKEKGIDVNIPENYYIDNDFNKKPLVRWRGHANLLFANWLNYYVYQ |
| A0A4R5Y5U3 | 5-73 | FINFNNKDIYINGHLEYAPNTLHTEYIRDCKKGLTISLPENYYAHDNSSNLVMRRWKPFADSFFNAFVT |
| I0XBV2 | 55-132 | None |
| H1D5M3 | 45-127 | None |
| A0A381IAY5 | 10-78 | None |
| A0A2D1KQ54 | 210-278 | None |
| A0A849ECP1 | 13-87 | None |
| E7NW37 | 222-304 | None |
| A0A556R5F6 | 209-304 | None |
| A0A7H4NT02 | 1-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.