DPCstruct | MC41117
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 128 ± 21 aa |
| Standard deviation of domain lengths | 21.07 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A328A0N6 | 11-129 | LSVLFLSACGKEDISNYIEKDFHGINGKGSISYEIDEDKIAREIYKVTSPTDEDLEKKGVYDELEALSDIEITANKEDNLKNGEKVK… |
| A0A844FQ41 | 20-134 | LIVLLVIALICGIYYGYAYVNKTKIDLSKNMTVHYIGISGLASVKYVDYHFSEDETNQYQKFLKTVRYHASKSSHLANGDQITITSD… |
| A0A251WQW1 | 333-420 | None |
| A0A417KMV8 | 29-169 | None |
| A0A5R8QFE5 | 150-255 | None |
| E7FXQ6 | 104-219 | None |
| A0A2P1G4G0 | 107-224 | None |
| A0A2Z5Z9I8 | 67-191 | None |
| A0A0R2LCL3 | 15-173 | None |
| A0A3B9FZN8 | 34-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.