DPCstruct | MC41116
Metacluster Properties and Pfam Annotations
| Number of structural domains | 885 |
|---|---|
| Mean domain length (aa) | 126 ± 27 aa |
| Standard deviation of domain lengths | 26.76 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 87.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.66 |
| Pfam Score | 89.62 |
| Assigned Pfam label(s) | CL0063- CL0209- CL0516- CL0300- CL0329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K2BEA7 | 142-251 | RFRPAKPVHQTGAWVKAATTAQVVPGKAFLATVGTQQIAWFNFNGKYYAIDNVCSHANGPLCQGSINGAVVTCPWHSSQFDITTGAV… |
| A0A0T6UJ50 | 5-120 | ARGWHCLGLSEWFRDGKPHKVKAFGTDLVVFEGETSKKLNVINAFCPHLGGNLAEGVIKGDSIACPFHDWRWNGEGKCTAIPYAKRV… |
| A0A533U8K1 | 3-94 | None |
| A0A835XUW6 | 444-569 | None |
| A0A835H6U2 | 421-508 | None |
| A0A523EHT2 | 5-106 | None |
| A0A535VUV8 | 47-184 | None |
| A0A7K3GT15 | 9-106 | None |
| A0A094HCH4 | 999-1125 | None |
| Q5B668 | 308-433 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.