DPCstruct | MC41115
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 132 ± 20 aa |
| Standard deviation of domain lengths | 19.80 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 93.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K2B6V8 | 22-143 | QANGFATYDKTVEGSVVNYENLDNHQTGIHDYFKYLKFGFGRATDIACLHLRRGRITRKDAIEMVNRHDGKFTWEYLGKSLEKILAP… |
| A0A3D8I1R6 | 126-266 | IFMGAIYPYGYLDSMHEARSVGFKDLEDFHEWYRQGAVEHFAQIDSIGYMVQYWCKFVKFGAQRTTDMATRLCREGAITREQALIYI… |
| A0A165K8Y3 | 159-287 | None |
| A0A1Z8SKY0 | 2-84 | None |
| A0A2E1MXK8 | 156-301 | None |
| A0A1F7VBT4 | 23-170 | None |
| A0A832B8R6 | 2-149 | None |
| A0A1F8CU51 | 16-159 | None |
| A0A2E7MNH8 | 64-213 | None |
| A0A1F5HWN8 | 11-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.