DPCstruct | MC41114
Metacluster Properties and Pfam Annotations
| Number of structural domains | 219 |
|---|---|
| Mean domain length (aa) | 134 ± 25 aa |
| Standard deviation of domain lengths | 24.61 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.85 |
| Pfam Score | 91.15 |
| Assigned Pfam label(s) | CL0039- PF01252- CL0105- CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K2AYT0 | 13-136 | VQDLLGRPYMMQGRVVHGDKRGRIMGFPTANIYLHRVATPVLGVYVVRMHNIARHGLPGVANVGTRPTMGGTRCLLEVHLFNFSDDI… |
| R7K850 | 3-93 | RVKLKSGVYATKCLVDGVEYISVTNVGDKPTFDDYSYTVESFLIDFNGTIYGETVKVAFYKYLRPIHKFSDSEELKKQIMSDADTAK… |
| A0A7S2SQW3 | 232-383 | None |
| H0EW55 | 1-150 | None |
| A0A7R9L1I1 | 17-147 | None |
| A0A7R9U213 | 100-252 | None |
| A0A1Z5T9F6 | 299-487 | None |
| A0A2K6UC96 | 71-207 | None |
| A0A843WXF1 | 117-260 | None |
| A0A821RVP1 | 9-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.