DPCstruct | MC41112
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 233 ± 48 aa |
| Standard deviation of domain lengths | 47.89 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 67.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.23 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | CL0003- CL0525 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C9K5S2 | 4-232 | VKSCPVETWTCEDVGNWLEEIGLEKFSDLFSKTHQIDGQVLLSLTEKDLREPPLQLNILGDIKRLSKHLRELKCQRLTNLPLSQNMH… |
| A0A6G0TDU2 | 3-249 | PVINWNPREVSIWLEKKGHSKYSQILTEDHCIDGRALLLINESDLKSPPISINVLGDIKRLMLDIRQLKVENRQSLLQLGFDPISLL… |
| A0A556UF89 | 207-454 | None |
| A0A498LUZ8 | 1-188 | None |
| A0A034VHS6 | 24-203 | None |
| A0A673B6P9 | 4-279 | None |
| A0A5J6SDF5 | 1-205 | None |
| A0A815ITK9 | 26-257 | None |
| A0A818APM0 | 21-227 | None |
| A0A815X8C3 | 1-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.