DPCstruct | MC4111
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 88 ± 10 aa |
| Standard deviation of domain lengths | 9.62 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A372IQD8 | 1-78 | MVSECINPACRQKLLYLRNGRVVRVTRQAHSVLQIEHFWLCGECFLRYDFHFLPGGEVEILPRAMPLSEEEPVVDLAF |
| A0A2V9SUA1 | 1-83 | MVSKCANPQCGAAFLYLHQGKLFRIETDAGWPQDPPDPSARKPIRRLEYFWLCDDCAAQMTLARKDGAVVTAPNVATRSAATA |
| A0A2P6WKL2 | 5-72 | None |
| A0A2W0A888 | 1-102 | None |
| A0A2V9Y9Y5 | 10-102 | None |
| A0A1Q6X7W5 | 34-137 | None |
| A0A7W1YE58 | 1-84 | None |
| A0A2V9DWM1 | 140-232 | None |
| A0A2Z5G2K8 | 1-87 | None |
| C1F776 | 28-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.