DPCstruct | MC41107
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 174 ± 41 aa |
| Standard deviation of domain lengths | 41.27 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 81.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C9JQD7 | 2-173 | CSVSASRLNAVDMAAYMVNSIHLMNTTLSLYEFTDARLEMLNAQTEAHLDTLVSEQASYILNRVGLAQMYGSIQQHRPEHGPLSSIS… |
| A0A7S1VXM3 | 47-221 | CDVVIESAMPYCRTLDDASSLRSALTTAKKAGLEIECSTKWDKAMSDQEKVILDRLIETETKRFLDQCGLGRLITSLEDMEHVYVDG… |
| S9X5W2 | 138-279 | None |
| A8JJ74 | 619-740 | None |
| U7Q6U0 | 511-742 | None |
| A0A820ZJK9 | 222-397 | None |
| W2Z639 | 2-192 | None |
| A0A1J8PQN0 | 915-1106 | None |
| D5AE91 | 2-140 | None |
| A0A3B0JK10 | 111-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.