DPCstruct | MC41105
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1842 |
|---|---|
| Mean domain length (aa) | 268 ± 56 aa |
| Standard deviation of domain lengths | 56.31 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 86.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.40 |
| Mean intra-cluster sequence similarity (%) | 12.61 |
| Pfam Score | 79.20 |
| Assigned Pfam label(s) | CL0489- CL0020- PF06417- PF20668- PF18140 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C9JPL3 | 36-285 | ESLKGELLGVVVQLGGQTPLKLGAMLVKYGVKILGTSFESIDLCEDRGRFRYFVNKFNLRQTNSVICDNLSCVIDESKKIEFPILIR… |
| G5LIM8 | 35-352 | KALREEGYRVILVNSNPATIMTDPEMADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALELERQGVLEEFGVTMIGATAD… |
| A0A1I8IQ12 | 306-568 | None |
| A0A0F9U3M5 | 48-296 | None |
| B7ZAW3 | 8-200 | None |
| A0A2B4SCH1 | 45-256 | None |
| A0A446PRH4 | 374-672 | None |
| A0A3C1GI31 | 6-169 | None |
| H3BCN4 | 51-370 | None |
| A0A7Z0GJ97 | 568-842 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.