DPCstruct | MC41104
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 140 ± 14 aa |
| Standard deviation of domain lengths | 13.73 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 40.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C9JMX0 | 1-150 | MLMEYGHNFSGPGNDVFRESRATLEPSEAHTSNFLHPVFYFYSSLPTESMMNCKSDAEIMPRPDFIHHVVEDFYTEWDRSHSHLLPL… |
| A0A0S7GGU6 | 46-161 | QYGKSKIDYLGLDRSETDWTRAWKSNFLHPVLYYYDSLPTEQDMKTRPHGWPLPRPKAIHHMVEDFLIEWDTPLSHIQPLRRFLEHC… |
| A0A6L5CG85 | 336-482 | None |
| A0A369S2T3 | 968-1094 | None |
| H2YH81 | 67-214 | None |
| S7NLB9 | 1002-1146 | None |
| A0A5N5TB05 | 279-416 | None |
| A0A1I8J6R3 | 436-567 | None |
| A0A6A4SGP4 | 385-537 | None |
| A0A1L8GNH3 | 494-656 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.