DPCstruct | MC411
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 181 ± 12 aa |
| Standard deviation of domain lengths | 12.24 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C7EGW0 | 94-272 | KAPILDGTAALATFCERAGYPSIEAAVAEQTVFLDPITVAQTHGGALFPVVRDQARRGQDATLPDGRRVVCCDNATPTRAFLWAADR… |
| A0A160PDI7 | 119-304 | DGRAVLDFLIAASPWGSIDQAIASLSLFAHPDVVTATGRRAVFRTVRGRTADRGTIVDGVMVDDNASPAAAFEWSTGLKRATTRDLT… |
| F8C6M2 | 1-198 | None |
| A0A0D0I466 | 106-288 | None |
| A0A543ACI7 | 81-253 | None |
| A0A2E3ESA6 | 3-176 | None |
| A0A1H6LG57 | 1-172 | None |
| A0A250FTT8 | 37-253 | None |
| A0A2K9E4C1 | 127-294 | None |
| A0A7I9YGG3 | 46-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.