DPCstruct | MC41096
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 188 ± 18 aa |
| Standard deviation of domain lengths | 17.92 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.48 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0059- CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A449ARU1 | 1-185 | MDQTTTISKRFVVHNMVTKVFVNDKLIKGGTDDYVVEMKRRYIGFKVKEQLKTGDVLTLEKVMSVHTSVDEKRLLKPEEIKEIAKQK… |
| A0A378VT93 | 11-197 | YIAAQTVANPFGVEQFIVNAGQTFAGSFKAFGGSQTDWQVSNSFEAEVGGTPETFEKRVIVTTSRDYQGLEAVKAAGRALSEKIAGV… |
| A0A377D1J9 | 102-277 | None |
| W4TPZ7 | 1-177 | None |
| A0A413LRU9 | 84-270 | None |
| A0A376SNR4 | 129-313 | None |
| A0A377LYV9 | 170-366 | None |
| A0A179IDC4 | 2-195 | None |
| A0A444U4F9 | 99-284 | None |
| A0A090W480 | 193-390 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.