DPCstruct | MC41094
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 80 ± 5 aa |
| Standard deviation of domain lengths | 5.31 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0111 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D7KG27 | 1-81 | MRSRVVRILFLMPSHSTPYYSTLHSNIPMQFLDYMPSEDKGEFDESDQFLMDLIGFASKLARNWSALPSHIVLFASEATKL |
| C3YQ48 | 238-309 | MSVLFLMPCHSTPFYSHVHHNISMRFLECPPDLERRPDYMDEADIFYQDPSAWLKNYYGPDVPLPTHLVMFN |
| A0A6A4W986 | 273-360 | None |
| A0A4Z2CL68 | 7-90 | None |
| A0A5N4AXB7 | 364-439 | None |
| V9IIU0 | 11-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.