DPCstruct | MC41093
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 88 ± 16 aa |
| Standard deviation of domain lengths | 15.56 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 70.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 49.20 |
| Pfam Score | 91.23 |
| Assigned Pfam label(s) | CL0361- PF14571 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067GDN6 | 33-98 | SIDDFEVEDDVRPDFPCPYCYEDFDIASLCSHLEDEHSCESKVTVCPICSVKVARDMLSHITLQHG |
| A0A2I0IAI7 | 13-96 | DRYGGALDEAGGEEQEPPPVEYTCPYCAEDFDILGLYCHMDEEHPIAVKAGICPVCAKKVGQEIVAHITIQHGNEFKISSNISL |
| A0A6A4NZ48 | 11-99 | None |
| M1D4Q7 | 9-117 | None |
| A0A397XHR6 | 31-123 | None |
| A0A2U1MRS1 | 146-224 | None |
| A0A2P2IKD4 | 21-105 | None |
| A0A396H8C2 | 14-94 | None |
| A0A484K8E7 | 30-118 | None |
| A0A0B0MTY9 | 1-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.