DPCstruct | MC41092
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 132 ± 17 aa |
| Standard deviation of domain lengths | 17.03 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 48.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0328 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0I2Y5 | 2-139 | LARWKQPVLVKGPLGIVSLFELSFFVMFIALLVWSFSTYLHNSLSTITAASIAEYGLKIKVWEYKLETAGFWLGIVGNIALAFLFFP… |
| A0A5A7QN08 | 295-402 | FVALCVWYFAYYVRHWFKQVPMLSMTRHEKTWQTKLDRVAIVTGVTGNLCLTFLFYPVTRKSSILPMIGLTSEASIKYHIWLGHMTM… |
| A0A835J6Z2 | 606-746 | None |
| A0A816PVV3 | 96-269 | None |
| A0A2K1J857 | 115-248 | None |
| A0A7J9LFE9 | 33-165 | None |
| A0A7J0G7R1 | 620-755 | None |
| A0A5N5N312 | 119-222 | None |
| A0A444ZMW7 | 586-721 | None |
| A0A7J8ZT30 | 95-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.