DPCstruct | MC41091
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 201 ± 23 aa |
| Standard deviation of domain lengths | 23.47 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 67.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14309 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0HXT0 | 4-196 | HPLGALDDGNIGTRNEAAGNLLQTRPIIVEEDVTDFNFVKDILKLGGFFQNEFIEPWESMDLPLNPKLFDDSEVSKLHGIECSDGQC… |
| A0A833R8J3 | 423-627 | ASLHDEVVQDDIVIVTSRTIKHEELPTQRTIFRLKEFDISSFLNPTYETPILDDKEIQSEFISVVVKASGLCRAGSERWRDDDPLLD… |
| A0A1S3VBG2 | 439-607 | None |
| A0A0A9NPX0 | 9-190 | None |
| A0A836DSC0 | 16-230 | None |
| A0A6P5N816 | 1-186 | None |
| A0A5N6P2I2 | 384-583 | None |
| A0A7N0UF78 | 720-961 | None |
| A0A5N6Q3S9 | 498-708 | None |
| A0A5N6PXN7 | 709-896 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.