DPCstruct | MC41090
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 176 ± 23 aa |
| Standard deviation of domain lengths | 22.92 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A094B4M9 | 14-173 | LSVVTATIPALTTLAPRAQPTASVDPWECITESLAQYLDVPKPTGSLFDELQSYAAELYEPCLAAITIEQCPFPGQSDWCAFTTAAP… |
| A0A6A6AN95 | 33-193 | STISPPALTTLFVPTSTPLPTSSQSPDPWQCATRNLTQYFDVPRPSAVLLSALESYGDKLIKPCLSTATGLNKLSCSVSETTQWCGF… |
| A0A1B8EJM9 | 20-167 | None |
| A0A6A7B7G6 | 23-191 | None |
| W9JNS3 | 18-210 | None |
| A0A2L2TPY3 | 106-311 | None |
| A0A1J7JR28 | 12-144 | None |
| F2S6P1 | 1-155 | None |
| A0A2S4KTC9 | 11-193 | None |
| W9N7T8 | 226-403 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.