DPCstruct | MC4109
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 90 ± 5 aa |
| Standard deviation of domain lengths | 5.35 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 46.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V4SPH7 | 38-124 | IPPGEERLHSDAERFAKLLVQEIALYHPKEMDQGRRQSNLYALLRDDIERSREAFQNRFQKPSIRSRDYFGKALVKYLANGDPSLLG |
| A0A2V9SE47 | 1-92 | MPPEEADIHRKAQRFARLLVDEIKLYNQAKVTEGRKNKDLYDRLKDEIEKSRATYQKRYGTTVAAAADYFNQEIVRSLAGDDGSLMG… |
| A0A2V8TVI9 | 84-164 | None |
| A0A7V9C3C8 | 433-522 | None |
| A0A7Y2GFX9 | 214-303 | None |
| A0A523D6C5 | 347-435 | None |
| A0A7Y4TTQ7 | 537-626 | None |
| A0A7W0NWB9 | 275-364 | None |
| A0A2V9JZ58 | 360-457 | None |
| A0A7Y2DSZ1 | 260-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.