DPCstruct | MC41082
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 127 ± 22 aa |
| Standard deviation of domain lengths | 21.91 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G8BEV0 | 9-132 | FYECQHVRPSGKKCRAIAIRDHRFCYFHLQSRRGYSAITPAAAVANGATAPAPQSATITLPMLEDRTAVQIVLTDVLRALAANQIDC… |
| A0A2W0BUU5 | 85-173 | APRCEHIKTNGEQCGSPAIKSTQLCYFHGETRKHRESEAAAKAAELPVLEDMQSIQLAVMRVCGLLASKAIEEKTARVLFDGLRLAQ… |
| A0A7G8BED5 | 2-139 | None |
| A0A7W8E197 | 2-126 | None |
| A0A3N1JKH5 | 10-151 | None |
| A0A3N1JPI2 | 1-134 | None |
| A0A428MGJ3 | 6-137 | None |
| A0A2W0BX17 | 115-205 | None |
| A0A495BRG8 | 21-142 | None |
| A0A7Y9PHU4 | 1-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.