DPCstruct | MC4108
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 101 ± 7 aa |
| Standard deviation of domain lengths | 6.88 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 23.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A534C3S1 | 1-97 | MTIKYQNYKHYKLPISINPLEYGKLIFKTDNIYIIQITSRTVSVISQYEDFNEVKFFKEGDLAFIYKDHKLDDNTFTRTLNNKKFTF… |
| A0A343C5H7 | 25-124 | RVPTHTFSNYKLPIEFHPSKYENVVKFNNYLYMVPLKDYYFIKIKFINKDLTKSKLFFKDQIVLEYSDRKIDDNSFVRFIGKNKYNF… |
| A0A385GNM5 | 136-214 | None |
| A0A649WI18 | 1-101 | None |
| A0A7T3PCP6 | 193-298 | None |
| A0A386TY72 | 129-238 | None |
| A0A534C3Z7 | 37-140 | None |
| A0A895KV26 | 120-219 | None |
| A0A343B740 | 125-230 | None |
| A0A2S0U3N2 | 28-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.