DPCstruct | MC41075
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 171 ± 21 aa |
| Standard deviation of domain lengths | 21.24 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 12.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A329Y824 | 4-184 | VEQVILSYQEDVPTNLLDDFKRHLDSSGIGLKTETRPINAYASFEWAVPTLIAVFILRSYFDAFFKEAGKDHYQILKAGVSLLLRKI… |
| A0A7J4RQZ4 | 3-162 | QGALVASLKYYGVSPWEVEVLYGLLHDMFAVEQIETEQDEDYSTMVDVFFPLEFSDEFFKWFGHMRWDKVKGILKEMKRRRGVGRHI… |
| A0A2A5HJT7 | 1-178 | None |
| A0A857HCQ7 | 2-170 | None |
| A0A3B0A3Q2 | 110-278 | None |
| A0A418NAN1 | 3-156 | None |
| A0A6L7R7H5 | 7-212 | None |
| A0A7W7L133 | 54-222 | None |
| C8WII5 | 10-165 | None |
| A0A7K2AC32 | 51-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.