DPCstruct | MC41071
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 188 ± 25 aa |
| Standard deviation of domain lengths | 24.89 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20717 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4F0L1 | 54-234 | LGPLPIGNDAIAIMRLVVQAQSIEKQVALIDAFAEITPEDKRVLSFEMARTGCVDQFYSRAQMLKVGGPAMLIYYSPAFLRNLAPAR… |
| A0A7S2LB92 | 434-615 | LPIGPAPTDSAAIAKMRLCCMAQMNAVAVLRGFEELPAGDQAVLSLEMSRTGCVGQQYSKGLVPSAAFEKDKGPAFLVYYGPAFLQN… |
| A0A813GG01 | 9-219 | None |
| A0A813HR25 | 392-559 | None |
| A0A812U3S9 | 608-775 | None |
| A0A7S0J2D4 | 55-245 | None |
| A0A7S0JDJ5 | 20-194 | None |
| A0A7S2N7H0 | 464-682 | None |
| A0A3N4S7K0 | 235-391 | None |
| A0A1Q9EPI2 | 156-371 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.