DPCstruct | MC4107
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 150 ± 12 aa |
| Standard deviation of domain lengths | 11.66 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 44.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7HRE1 | 401-549 | VFDRSKPLPTGGYLEQADGTAWMAFYCTVMLSIALELAVWKDPSYEDMASKFFEHFVDISDAMNHKGLWDEEDGFYYDQLRFDERRE… |
| A0A822BJ15 | 182-330 | HQSDGTAWMCFYSLIMFTISIELAGGINGEPVSEAYEDMASKFFEHFVQIVDAMNVHGGTGLWDDDDGFYYDQVKCGKTDKMTILKT… |
| A0A7D8Z176 | 337-487 | None |
| A0A1F7RS87 | 314-458 | None |
| A0A651FPA9 | 19-180 | None |
| A0A167F813 | 507-669 | None |
| A0A1Q3E6F5 | 59-206 | None |
| A0A813CTH0 | 576-719 | None |
| M7TDW6 | 190-353 | None |
| A0A813KX54 | 99-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.