DPCstruct | MC41060
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 90 ± 16 aa |
| Standard deviation of domain lengths | 15.64 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 55.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05687 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453SEP4 | 1-62 | WRERENNRRRERRRRAIAAKIYTGLRAYGNYNLPKHCDNNEVLKALCNEAGWVVEPDGTTYR |
| A0A5D3CQD8 | 66-149 | RGSSGRTPTWKERENNKRRERRRRAIAAKIYTGLRAQGNYKLPKHCDNNEVLKALCNEAGWVVEEDGTTYRKGCKPPPIDIGTS |
| A0A0E0JET3 | 22-101 | None |
| A0A6P6FVR7 | 127-222 | None |
| A0A1Z5RM89 | 28-105 | None |
| A0A834TN13 | 5-102 | None |
| A0A6V7PNQ6 | 105-186 | None |
| A0A2C9VB84 | 10-103 | None |
| A0A6J0PCU7 | 1-106 | None |
| A0A022R439 | 1-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.